| Protein or peptide name: | Blr |
| Chromosome: | K-12 substr. MG1655, complete genome |
| Protein or peptide start site: | 1704551 |
| Protein or peptide end site: | 1704676 |
| ncRNA start site: | 1704551 |
| ncRNA end site: | 1704676 |
| Genome Browser: | NA |
| Protein or peptide sequence: | MNRLIELTGWIVLVVSVILLGVASHIDNYQPPEQSASVQHK |
| Protein or peptide length: | 41aa |
| ncRNA type: | ncRNA |
| ncRNA name: | blr |
| Entrez ID: | 2847682 |
| Experimental species: | Escherichia coli |
| Experimental techniques: | Western blotting |
| Experimental sample (cell line and/or tissue): | E. coli |
| Description: | The Blr protein has 41 amino acids, with a single predicted transmembrane helix, but no clear homology to any other protein. |
| Subcellular location: | transmembrane |
| Function: | The Blr protein has 41 amino acids, with a single predicted transmembrane helix, but no clear homology to any other protein. |
| Title of paper: | Intergenic’ blr gene in Escherichia coli encodes a 41-residue membrane protein affecting intrinsic susceptibility to certain inhibitors of peptidoglycan synthesis |
| PMID: | 10931331 |
| Year of publication: | 2000 |
